PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011087607.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 236aa    MW: 25823.7 Da    PI: 8.2392
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011087607.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF60.32.3e-192369349
                    --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
          SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                     e +sn qvtfskRr g++KKA+EL++L++ e+av++fs+ +k + +
  XP_011087607.1 23 MEKESNLQVTFSKRRVGLFKKASELCTLTGSEAAVVVFSPGNKAHSF 69
                    57899************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-281372IPR002100Transcription factor, MADS-box
PROSITE profilePS5006621.4041373IPR002100Transcription factor, MADS-box
CDDcd001202.40E-271472No hitNo description
SuperFamilySSF554557.19E-221482IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-141535IPR002100Transcription factor, MADS-box
PfamPF003194.6E-222269IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-143550IPR002100Transcription factor, MADS-box
PRINTSPR004042.4E-145071IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MSSSDPSQNK KNKGRRKVNM TKMEKESNLQ VTFSKRRVGL FKKASELCTL TGSEAAVVVF  60
SPGNKAHSFG HPDVHTVANK LLAPNSSPGD VANRSNHVFQ QGSTRNSENE LKYLAEVERQ  120
IEAERARGEE IERMRKACEK EKWFPSADVI EGLSYQQLEH LKGAVVDFGK NLETQVGRRG  180
VGPGGGEGFL FGAGASSEHA AVFQYNTVIP YDQGATRAGE EDMSQDFNAG YGPGHF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011087607.11e-177PREDICTED: agamous-like MADS-box protein AGL62
TrEMBLA0A022R0V16e-73A0A022R0V1_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1979623
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.12e-31AGAMOUS-like 62